PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016117-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 269aa    MW: 30247.5 Da    PI: 7.1429
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016117-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-164386146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    NNU_016117-RA 43 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 86
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-212395IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-102349IPR009057Homeodomain-like
PROSITE profilePS500904.3562437IPR017877Myb-like domain
PROSITE profilePS5129423.2463892IPR017930Myb domain
SMARTSM007171.3E-144290IPR001005SANT/Myb domain
PfamPF002494.2E-154386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-185087IPR009057Homeodomain-like
CDDcd001671.22E-76386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAKVAGTPSL DAQGVLKPGT GLKRTGKSCR LRWLNYLRPD VRRGNITLEE QLLILELHSR  60
WGNRWSKIAQ HLPGRTDNEI KNYWRTRVQK HAKQLQCDVN SKQFKDTMRY LWMPRLVERI  120
RAAAAASSGA NTTTTSPTTT HHQIYNNNSD VITGQVLSSA GSNNEYGVSQ INASFTPENS  180
STAGSSELSV GTQVSPVSDL TDYYNFQPNN YADNFHASQV NYQESLTSPT GYFNQGLDFE  240
AIEQNNMWLG DGDVSDNLWN VEDIWLLQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-17249040106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270853.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE17e-68MY108_ARATH; Transcription factor MYB108
TrEMBLB9HIK11e-113B9HIK1_POPTR; GmMYB12 family protein
TrEMBLB9HX621e-113B9HX62_POPTR; Uncharacterized protein
STRINGPOPTR_0008s10080.11e-113(Populus trichocarpa)
STRINGPOPTR_0010s15970.11e-113(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.13e-67myb domain protein 108